optional Stadt:
Luxemburg › Ort ›

Bous › Remich › Luxemburg › 5408 Erfahrungen

Branchenbuch Bous

5408 Remich

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 deLadevoBade CBD Shop ch
CBD ist unsere Leidenschaft. Wir haben 6 exklusive CBD Sorten, CBD Tinktur und CBD Öl im Angebot. Alle CBD Produkte...
deladevobade.ch Z Y
2 Boilerkings Boiler ch
Warmwasser? Ja gerne!...
boilerkings.ch Boiler Warmwasser Kings Warmwasseranlagen Tobelacher Baden Rütihof Internetauftritt Steffen Rtihof Neuenja Demnchst
3 Loogo Umzüge Österreich Umzüge at
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und...
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
4 Hundetrainer Hundetrainer Hundeschule Hundetraining ch
Wir trainieren nicht Ihren Hund, wir trainieren Sie, damit Sie Ihren Hund trainieren können. Hundetraining in alltäglichen Situationen, denen wir immer...
hundeschule-aargau.com Hundeschule Erziehungskurse Junghundekurse Hundehalterbrevet Agb Clicker Training Uns Feedbacks Verhaltensanpassungen Aargau Wettingen Baden Trainieren Umgebung Fislisbach Nussbaumen
5 Adless Mediendesign e.U. Webdesign at
wir gestalten Medien - Web, Grafik & Druck...
adless.at Navigation Offsetdruck überspringen Webdesign Relaunch Augenhöhe Werbeagentur Grafik + Grafikdesign Angebot Web Uns Rufen Beratung
6 Ihr Schweizer Mietportal Baumaschinen-Vermietung ch
Wir sind rentscout Ihr Schweizer Mietportal. Finden Sie auf rentscout alles zum mieten und vermieten. Wir führen das ganze Sortiment...
rentscout.ch/produkte/bau-landwirtschaft.html Zubehör Zelte Toiletten Duschanlagen Tontechnik Bus Mobiliar Bühnen Car Küche Pflanzen Aufzüge Container Dekorationen Bodenbeläge Reinigungsgeräte Stretch Limousinen Rsaquo
7 Loogo Umzug Umzug Umzüge at
Jeder Umzug wird von uns mit höchster Priorität und Wichtigkeit behandelt und mit Freundlichkeit, Professionalität und vor allem kundenorientiert zum...
loogo.at Salzburg Umzug Umzugs Loogo Lagerung Mail Kontaktieren Eu Transport Kalkulator Firmenumzug Besichtigungstermin Kunden Kostenlosen Storage Self Entrümpelung
8 1820 Telefonauskunft der Schweiz Kommunikation Dialog ch
1820 - Die Schweizer Telefonauskunft mit persönlichem Service erfahrener Schweizer Mitarbeiter/innen. Nationale und internationale Auskünfte aller Art, rund um die...
18-20.ch Z Y
Google Anzeige:

9 Praxis Dr. Wanner Arzt ch
plastische Chirurgie Wiederherstellungschirurgie, ästhetische Chirurgie, Face Lifting, Nasenplastik, Tumorchirurgie, Brustvergrößerung, Brustverkleinerung, Bruststraffung, Bauchdeckenstraffung, Liposuction, Brustrekonstruktion, Botox, Hyaluronsäure, Faltenbehandlung, Peeling, Narbenkorrektur...
aesthesis.ch Chirurgie Damit Aesthesis Unerwünschte Navigation Alters Aktuell Behandlungen Unfälle Zeichen Praxis Gemäldeausstellung Nachbetreuung Return Physikalische Plastischer Einfluss
10 Wimpernverlängerung & Nail Wimpernverlängerung & Nail Cosmetic ch
Im Studio SALANA Lashes & Nails in Ennetbaden bieten wir Ihnen alle Behandlungen an die zur Pflege und Verschönerung Ihre...
salana.ch Lashes Wimpernverlängerung Nails Remigen Salana Ennetbaden Chf Pedicure Statt Manicure Shellac Portrait Gelnägel Seidenwimpern Wimpernlänge Ennetbadensonnenbergstrasse News Frick
11 EMCO Werkzeugmaschinen Drehmaschinen Fräsmaschinen Fräsen at
EMCO ist ein weltweit führender Werkzeugmaschinen Hersteller von Drehmaschinen und Fräsmaschinen. Der Erzeuger arbeitet nach modernsten und internationalen Standards und...
emco-world.com/ Emco Cnc [] Ausbildung News Fräsmaschinen Industrie Produkte Drehmaschinen Erzeuger Drehen Kundenservice Kundendienst Unternehmen Consulting Ersatzteile Schulungen Leistungsfähige Gebrauchtmaschinen
12 REYERlooks Designermoden Onlineshop Onlineshop Mode at
Designermode im Fashion Online shop REYERlooks! Die neuesten Trends den richtigen Style und die besten Designer. Designermode ohne Kompromisse! DER...
reyerlooks.com/ Trends Designer Reyerlooks Shop Fashion Mode Kleider Taschen Designermode Urban Mäntel Bags Schuhe Röcke Jacken Passend Winter Shoes Sicher Anrede*
Google Anzeige:
13 PC-Reparatur COMPUTER Service at
Herzlich Willkommen bei Ihrem CXPC-Service Team für Computer, Büro, Gaming, Multimedia PC´s und Ersatzteile. Wir haben unser Interesse für Computer...
cxpc-service.at Pc Computer Cxpc Finden Radeon System Amd Pc´s Budget Beratung Systeme Mini Technik Erfahrung Reparatur Kontaktformular Nutzen Edv Dienstleistung Ihrem
14 Nailstyling Fiedler Nailstyling Fiedler Naildesign ch
Naildesign, Gelnägel, Permanent Nagellack CND, Wimpernverlängerung, Wimpernverdichtung, Manicure, Pedicure...
nailstyling-fiedler.ch Domain Kas Mail Movetec Thema Nailstyling Switch Fiedlerch Domains Logo Schweiz Angriffe Ab Registrar Betriebsferien Fiedler Kunden Level Kundenmeinung Queensbeautych
15 Nailstyling Fiedler Nagelkosmetik ch
Naildesign, Gelnägel, Permanent Nagellack CND, Wimpernverlängerung, Wimpernverdichtung, Manicure, Pedicure...
16 Helga M. Schnattinger Alternativmedizin at
Kinesiologie, Tuina, Familienaufstellung sowie Schamanismus und Rückführung bietet Helga Schnattinger in Hallein bei Salzburg - Gesundheitstrainerin und Diplomtherapeutin für traditionelle...
helga-schnattinger.at/ Kinesiologie Tuina Schamanismus Rückführung Helga Schnattinger Familienaufstellung Salzburg Hallein Seminare Sowie Kintao Reinkarnation Homöopathie Familienstellen über Meiner
17 New Media Context Lektorat ch
Die beste Adresse für Lektorat, Lehrmittel- und Medienprojekte. Spezialisiert auf das Lektorat von Bachelor-, Master-, Doplom- und Doktorarbeiten begleitet NMC professionell...
nmc.ch Lektorat Lehrmittel Dissertation Masterarbeit Hilfe Media Context Nmc Studienabschluss Diplomarbeit Bachelorarbeit Projektleitung Medienprojekte Projektplanung New Mdash Mail
18 Sylvi Nicolai, Dolmetscherin und Dolmetschen ch
Sie organisieren eine Konferenz oder benötigen für Geschäftsverhandlungen, Führungen oder Präsentationen einen zuverlässigen Dolmetscher? Oder benötigen Sie eine Übersetzung Ihrer...
sprachendienst.ch Translation Dolmetschen Baden Zürich Bern übersetzen Lektorat Interpreting Traducción Deutsch Sylvi English Schweiz Partner Kommunikation Kongresszentrum übersetzungen Agency Copyright
19 Mertl-Kunststoff GmbH Kunststoff und at
MERTL Kunststoffe GmbH - Verschiedenste Produkte wie : Thermoplastische Werkstoffe Duroplastische Werkstoffe ICE FLOOR 365 Eislaufen ohne Eis Gleit- und Förderelemente Rammschutzleisten nach Wunsch kompetenter Partner...
mertl-kunststoff.com Kunststoffe Mertl Thermoplaste Icefloor Duroplaste Fertigteile Halbzeuge Plastix Förderelemente Erfahren Gleit Stellenanzeigen Zertifikat Kunststoff Zuschnitte Premium Werkstoffeund Hochleistungskunststoffe Sowie Pe Werkstoffe Unser
20 Wie können Texte extern Bildung ch
Mäderstrasse 2
Textidee bietet einen einfachen Weg, die Idee, die druckfertigen Text. Jeder schreiben, bearbeiten und die Jahresberichte korrigieren, Unternehmensbroschüren , Redaktionelle...
textidee.ch/ Gregori Regina | Direkt Inhalt Dienstleistungen Textideech Ankommenmich Textidee Z
21 Handeys Finanzen - Kredit Kredit ch
Kredit, Geldanlage, Darlehen, Privatkredit, Kredit Vergleich, Express Kredit, Kredit ohne ZEK, Sofortkredit, Reisefinanzierung, Schönheitsfinanzierung oder Kredit für Selbstständige? Sind Sie...
handeys-finanzen.ch Kredit Handeys Ferien Finanzen Konditionen Teilzahlung Privat Zürich Express Privatkredit Schweiz Darlehen Sofortkredit Kredite Vergleich Nebenjob Abwicklung Badeferien
22 Psychotherapeutische Praxis Psychotherapie ch
tafra.ch Romy Fsp Psychotherapie | Tafra Fachpsychologin Licphil Sprachentarife Mich Angebotpraxis Mein Baden
23 Joya City Shop Schuhe at
weichster Schuh der Welt ideal bei Hallux und Fersensporn schon Rücken und stärkt Muskulatur Gelenkschonend...
joya-cityshop.at Joya Schuhe Shop Gesunde Komfortschuhe City Schöninger Erfolgsgeschichte Gehen Hallein Alois Kellner Schwelle Wegbereiter Cityshopat Wwwjoya Nater Shophallein
24 Medienquartier Werbeagentur at
Internetseite, Webseite, Grafiker, Webdesigner, Werbung, Visitenkarte, Plakat, Broschüre, Logo, Briefpapier, Kuverts, Postkarten, Rollups, Fahnen, Beachflag, Marketing, Social Media, Corporate Design...
medienquartier.at Project Salzburg Grafikdesign Webdesign Hallein Werbeagentur | Medienquartier Work Details Contact Print Cafe Genuss Wahre Maria Consulting
25 Laserer Küchenstudio Salzburg at
Küchen sind nicht nur Orte, in denen man Essen zubereitet, sie sind in zahlreichen Fällen ebenfalls Begegnungsstätten. Das Abendessen, wird...
laserer.at/de/kuechen-wohnen/kuechen-kuechenplanung/kuechenstudio-salzburg/ Küchen Küchenstudio Wohnen Salzburg Gosau Hallein Laserer Tischlerei Marken Planung Anfahrt Küchenstudios Siematic Maß Traditionell Einbauküchen
26 moser - productagent Handel at
Handel mit Werbemittel, Weihnachtsgeschenke, Betriebsaktionen, Produktsuche, Produktvermittlung, Hallein, Salzburg, Österreich, Producthunter,...
productagent.eu Werbegeschenke Werbemittel Werbung Betriebsaktionen Weihnachten Hallein Salzburg Präsente Wien Business Tennengau Kärnten Linz Vorarlberg Flachgau Kundengeschenke Werbemitteloberösterreich

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Bous

+ Kommentar oder Kleinanzeige für Bous eintragen!

StadtBranche.lu Orts-Portrait von Bous in Remich Luxemburg. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Bous erhält 3 StadtBranche.lu Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. - Stand: + Kontakt

Remich ▪ 5408

Bous ist der Name folgender Orte:
