About Bewertung Luxemburg

About


Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 About us www.tennisclubsenningerberg.lu

About us www.tennisclubsenningerberg.lu ... Tennis Club Senningerberg About us Nos installations Our facilities Contact Board/Committee TENNIS
tennisclubsenningerberg.lu
2 About accueil

accueil ... About Missions & Activities News & Events Members Contact About GLAE «Groupement Luxembourgeois de
glae.lu Accueil
3 ACGYDD About the young

In April 2010 a new project idea which given its novelty and ambitious ... driving skills whilst also learning something about road safety. The highlight of the event is our Master
safetydays.lu Young Drivers Day Young Safety
4 Iechternach: Visit Echternach Iechternach

On iechternach.lu you can find everything about Echternach in Luxembourgish Echternach is called Iechternach. ... curious to know all about Luxembourg´s oldest town? Are you planning to visit Echternach - or Iechternach
iechternach.lu Iechternach Echternach Luxembourg Mullerthal

5 Aperam About

... Skip to navigation Skip to content Aperam Aperam Navigation About Aperam Organisation General
aperam.lu
6 About us

... Talent Acquisition Social Media Recruitment Consultancy Corporate Development About Us Local
theark.lu
7 MGMT About

... About Luxembourg Structures & Advantages SOPARFI Securisation SICAR SICAV SIF IPCopyrights and
mgmt.lu
8 About Us IMS

IMS Integral Maritime Solution A European shipping company based in Luxembourg duly dedicated ... Integral Maritime Solutions Home Contact Main menu Home About us Services Luxembourg
inmarsol.lu IMS Integral Maritime Solution European Shipping
9 FUTURA BOLD ? misc

CODESIGN WORKSHOP JUNE 27th29th 2013 spatial speculations scenarios strategies for Luxembourg and the ... and the Greater Region Archive Subscribe FEEDBACK Random ABOUT SUBJECTS XS S M L XL ATLAS DATA MISC
futurabold.lu Misc Data Stats Info About
10 Dete | mad about creative

... dete mad about soul home about soul team works contact facebook we are... mad about strategies
madaboutsoul.lu Creative Communication Consulting Conseil Créativité Création
11 All about Computer Solutions Windows

Your partner for the Future.In Windows Mac and Linux environment ... All about Computer Solutions Diese Website ist zurzeit im Wartungsmodus. Bitte später wiederkommen
aacs.lu Windows Mac Linux IT WEB Network
12 About Avialux News avialux

Avialux ... About Avialux Baptêmes The Fleet Become a member Shop About Avialux & News About Avialux Written by
avialux.lu Avialux Avialux AviaLux Bapteme
13 About : raphaëL raphael

raphael.lu photographer for portfolio fashion events travel and fine art. ... raphaëL PHOTOGRAPHY Home About raphaëL Travel Color Black and white People and Faces Color Black
raphael.lu Raphael PHOTOGRAPHY Black White
14 About Free/OpenSource software LiLux

LiLux LIbre LUXembourg ... Main Menu About Free/OpenSource software FreeSoftware/Freeware Linux/FOSS market share Software choice
lilux.lu LiLux Linux Libre Free
15 About us | Lentzeparc

... About us Restaurant Photo Gallery Contact Notre histoire Notre philosophie About us Suggestions
lentzeparc.lu
16 Plottké Associates : avocat

Plottke and Associates Attorney at Law is closely associated with corresponding law firms in ... About Us Our Services Networks Pro Bono Contact Us Recruitment rue d'Anvers BP L-
plottke.lu Avocat Luxembourg Avocats Luxembourg Lawyer Luxembourg
17 About Us | ellemka

... PRODUCTS CONTACT US About Us ELLEMKA s.à r.l. is a specialist retailer in health technologies which are
ellemka.lu
18 About HL7 Luxembourg – start

... Navigation home News Agenda HL Material About HL Luxembourg Organisation and members Joining the HL
hl7.lu Start
19 OtimO business solutions OtimO
1018
Luxembourg
As independent business solutions provider OtimO's core strengths lie in Defining innovative and fresh ... don't hesitate to contact us by or by phone. About Us Services Solutions Imtiaz Contact
otimo.lu OtimO Imtiaz ImtiazFunds Alternative
20 The Black Stuff ::: irish

An authentic Irish Pub. Complete with blackened rafters a log fire a warm ... About What's on? TV Sports Pics Drinks Links The Black Stuff Irish Pub Val de HammPulvermühle
blackstuff.lu Irish Pub Luxembourg Sports TV
21 Bienvenue au Luxembourg location

Luxemburg Europe Expatriates and about Luxemburg Residence Permits. ... . Home About Us Gallery Products Contact Habitasse © Curabitur felis erat. Mauris di Serif. Vestibulum
montereycenter.lu Location Bureaux Equipes Pour Expatriés Location Bureaux
23 About Lc Kayl
3601
KAYL

lckayl.lu
24 Claude Barthels Computer Claude

A website about Claude Barthels PhD student in Computer Science at ETH Zurich ... Claude Barthels About Resume Leisure Time Contact Claude Barthels M.Sc. ETH in Computer Science I
barthels.lu Claude Barthels Biography Curriculum Vitae
25 Flexibility through Liquidity |

Hawk finance offer trade receivables financing find out more about us today. ... Sprache ändern + infohawkfinance Home About Us Services Partners Client Zone
hawkfinance.lu
26 Heli.lu RC Helicopters rc

heli.lu The Luxembourg RC Heli site. Pictures Movies Setup Reviews ... Site! You will find interesting informations about radio controlled helicopters in Luxembourg and
heli.lu Rc Heli Rc Helicopter Rc
27 ImproveIT Consulting start ITIL

Velkommen til ImproveIT Consultings hjemmeside ... Main Menu Home/Blog About ImproveIT Private clients Corporate clients Community Trade Marks Contact
improveit.lu ITIL Prince2 Project Management DS484
28 Moving Storage Psf

Learn more about International European and national moving secure storage Archiving ... About Us The Company History Timeline Our team Jobs Trust Certificates Networks Quality Report PSF
streff.lu Psf Moving International Strassen Windhof
29 Luxembourg Group asset

... Go to website navigation Skip to main content Group Home About Us Investor Relations Media Centre
aberdeen-asset.lu Asset Management Global Investment Management About
30 Office Freylinger | Patent
8001
Strassen Luxembourg
Patent and Trademark attorneys in Luxembourg providing client oriented and tailor made services ... » Online services >>> Trademark search Domain search Patent search Home About us Our services Knowledge
freylinger.lu
31 Befashion.lu the mag


befashion.lu
32 News about salsa events salsa


salsanews.lu Salsa Luxembourg Trèves Cours
33 Masterchef cook

cooking for fun or as masterchef. Enjoy food as you like it. Just experience with ... MASTERCHEF Start Videos Recipes Favorite restaurants Comments About me Masterchef for food lover
masterchef.lu Cook Fun Danmark Danish
34 Home Propeller

The Propeller Club was founded in the USA in 1927. There are about 10 000 ... Home About us xhtml The Propeller Club The Propeller Club was founded in the USA in . There are
propellerclub.lu Propeller Club Luxembourg Maritime Industry Shipping
35 Agile Linux

This blog is where I post interesting things I've learned during my day to day ... Agile - LinuxWebCloud & Open Source About me Posts MayThe Rule of PowerPoint
odr.lu
36 MBSL The Train Specialists CFL

All about the small train Alles uuml;ber die Modelleisenbahn Trains miniatures toutes échelles Modèles réduits Luxembourg Mauml;rklin ... -Onlineshop News About Us Videos Horaires Contact Links Terms sigplus PreviousNext Shop Brass
roco.lu CFL Chemins De Fer De Luxembourg
37 Guitar.lu home concert

This site is not just about guitar it's about music. The music of Cary
guitar.lu Concert Konzert Recital Rezital Perform Performance Guitar Guitare
38 Plain Vanilla plain

Everything you have to know about the bar Plain Vanilla in Luxemburg
plainvanilla.lu Plain Vanilla Plainvanilla Plain Vanilla
39 Luxembourg Banking Investments

Information portal and social network devoted to CFO Treasurers auditors tax specialists ... Skip to main content Home News Interviews Jobs Events About Search form Search Petercam – Degroof
warren.lu
40 BENELUXLIGA The website Handball

Find all information about the BeneluxLiga Handball Cup. One tournament between Belgium Luxembourg and
beneluxliga.lu Handball Luxembourg Fédération Federation
41 Sur Mesure Aménagement sur

Sur Mesure Aménagement et Décoration d'Intérieur
surmesure.lu Sur Mesure Luxembourg Interior Design
42 Actualités DiddelengHelleft organization
3401
DUDELANGE
Find out more about our global development movement join us and help us make
diddelenghelleft.lu Organization Membership Donate Volunteer
43 Home The British charity

Find out more about our charity and global development programs join us and help
britishstand.lu Charity Philanthropy Donations Community Service Volunteerism Fundraising Volunt
44 YourTown® découvrir votre your

Discover your town. All information about your town. The community portal not for Germany only.
yourtown.lu Your Town Yourtown Luxembourg Community News Addresses Pictures
45 The town of Diekirch diekirch

On dikrech.lu the visitor sees a collection of old postcards from Diekirch. Furthermore
dikrech.lu Diekirch Luxembourg Luxemburg Cavalcade
46 Adecco the world international
6639
Wasserbillig
Adecco International Search for a job by country find a local branch office or
adecco.lu International Job Search Staffing Agency Temp
47 Lex + pit weyer
2311
luxembourg
lex + pit weyer créations publicité graphic graphic design web site design ... start about work contact links
weyerdesign.lu
48 ABB in Benelux

ABB Benelux est la représentation régionale d'un groupe aux dimensions mondiales ABB. Les collaborateurs
abb.lu
49 Steiler

... HOME MENU ABOUT EVENTS Contact HOME MENU ABOUT EVENTS Contact Menu PrevNext
steiler.lu
50 PEGASUS

... Home About Contact Tweets by PegasusAgency ©PEGASUS AGENCY S.A.
pegasus.lu
51 CFOWorld Accueil CFO

CFO World is a financial directory information portal and social network devoted to CFO
cfoworld.lu CFO Finance Management Social Network SOCIAL
52 Marilù

... Home News About Menu FRAGILE NEW EP OUT NOW! Home News About PrevNext Back to Top info
marilu.lu
53 Startpage | Link Management Art
48149
MUNSTER
LINK Management envisions art advisory as a reliable guidance through every stage of the constitution ... HOME ADVISORY ART LENDING RESEARCH NEWS ABOUT US LINK ART INVESTMENT STARTPAGE
link-management.lu Art Consulting Art Advisory Art Services
54 BONOM

... BONOM a new gag each week random gag by DoM about links some rights reserved
bonom.lu
55 Techup.lu Luxembourg Tech/Hacker/Geek agenda

Techup.lu Is a community driven meetup listing site for technical and nontechnical events. Whenever ... Skip navigation Toggle navigation TECHUP.LUBETA Events About Login Upcoming Past Submit Event
techup.lu Agenda Technical Workshops Presentation
56 Sumo

... ©Sumo About Sumo Contact Shop Facebook Canvas art canvas paintings Walls Prints
sumo.lu
57 Grey Station grey

Grey Station is a luxembourgish rock band founded in 2013. ... News Shows Music Store Lyrics Pics About Contact © Copyright Grey Station Created by ND
greystation.lu Grey Station Luxembourg Rock Band
58 BELVEDERE real estate

... About you About us Services Real Estate Information Contact route de Thionville - L-
belvedere.lu
59 Blank Title Home

... Tandem Partners SÃ rl Home Services About Us Contact Finance Transportation Restructuring
tandem.lu
60 Home

...  Home " Contact Sponsors Driver About Us Media Home This web page requires a JavaScript enabled
msfd.lu
61 MACL International Ltd

IP rights management ... MACL International Ltd IP rights management company Home About us About IP rights Our team Home
macl.lu
62 MONITORit Keeping patients

... Have a look on the movie to learn more about the Integrated Home Health Station free software
monitor-it.lu
63 Home JbIT.lu

JbIT is a Luxembourg recognized brand at the forefront of implementing technology to create the ... Projects News About Us Contact Projects News About Us Contact JbIT Home Page Projects News About Us
jbit.lu
64 JCILuxembourg

... Search this site Welcome Contact Announcements About JCI Luxembourg Calendar Projects Photo Album
jci.lu
65 Studio Frank Weber Photography

... slideshow off portfolio spots about us references books contact © STUDIO FRANK WEBER - all rights
frankweber.lu
66 Dancecouncil.lu

... HOME NEWS ABOUT US SCHOOLS & CLUBS AMATEUR LEAGUE CALENDAR LINKS CONTACT US HOME
dancecouncil.lu
67 Web hosting provider web

Bluehost Top rated web hosting provider Free 1 click installs For blogs ... Contact Us About Us Affiliates Terms © Bluehost. All rights reserved.
iwwersetzer-dolmetscher.lu Web Hosting Provider Php Hosting Web
68 Karin Krommes Art

... Karin Krommes Karin Krommes About Artist statement Paintings Landscapes I Landscapes II Aircraft
ksk.lu
69 ROUTE 66

... En Fr Home >> Home >> About us >> Price list >> Promotion >> Location >> Contact h.png h.png h
route66.lu
70 Home

... HOME ABOUT WORK CONTACT PHOTOS ATELIER PHOTOS VITRINES PHOTOS VOITURES PHOTOS DIVERS Copyrights
lettrage.lu
71 Sseik. atelier graphique sseik.

Content description ... → ← close menu Sections FILTERS ABOUT NEWS CONTACT sseik. work
sseik.lu Sseik. Atelier Graphique.
72 JeanPaul Frisch – Home

... Jean-Paul Frisch About Guestbook Contact Copyright Aerial I - Fauna I Flora I New
psf.lu
73 Feel Good Group Feel

FeelGood le prêtàporter féminin depuis 1994. FeelGood s’adresse à une clientèle jeune dynamique et qui ... Choose your language >> Store locator Partnership Jobs Home News About us Collections
f-g.lu Feel Good Feel Good Feelgood
74 HOME

... Startseite ABOUT US ACTIVITE NEWS SHOP GALLERIE DOWNLOADS ARCHIVE LINKS
mototravel.lu
75 Web hosting provider web

Bluehost Top rated web hosting provider Free 1 click installs For blogs ... Contact Us About Us Affiliates Terms © Bluehost. All rights reserved.
translators-interpreters.lu Web Hosting Provider Php Hosting Web
76 Tuys.lu

... Home About News Media Gigs Shop Contact •retrosepective• •Wayout• ©Tuysall rights reserved
tuys.lu
77 Web hosting provider web

Bluehost Top rated web hosting provider Free 1 click installs For blogs ... Contact Us About Us Affiliates Terms © Bluehost. All rights reserved.
uebersetzer-dolmetscher.lu Web Hosting Provider Php Hosting Web
78 DEAN the bar dean

Dean is a modern metropolitan bar in the nightlife area rives de clausen. Besides being ... main page About About Map Contact Weekends Terrace Sports Rent Chicken Kitchen I feel sorry for
dean.lu Dean Bar Rives Clausen
79 LS Quarter horses LS

LS Quarter horses ... HOME STALLIONS MARES SALE HORSES ABOUT CONTACT SNAPPER WHIZ IT SPOOKALICIOUS Webdesign by GR-ink
ls-quarterhorses.lu LS Quarter Horses Midori Grink
80 Home AVCaesar

... Toggle navigation Articles Malware repository CERT Services About Home Sign in Sign up AVCaesar is
avcaesar.malware.lu
81 CEI Communication Events

... WORK What we do COMMUNICATION EVENTS INTERIORS I ABOUT Who we are CLIENTS I CONTACT Where we are
cei.lu
82 Manu's Space

Personal website of Manu Fiermonte ... Latest Munich Travel Blog Magazine Instagram About Contact Menu Latest Munich Travel Blog Magazine
manu.lu
83 Yogaloft Luxembourg yoga

Yoga classes in Luxembourg ... home about yoga about yogaloft terms & conditions privacy policy teachers
yogaloft.lu Yoga Calm Serenity Power Sport Luxembourg Classes India
84 Indian Business Chamber of Indian

Indian Business Chamber Of Luxembourg based in Strassen Luxembourg is a nonprofit organization promoting ... Indian Media About IBCL About India Doing Business with India About Luxembourg Doing Business with
ibcl.lu Indian Business Chamber Of Luxembourg IBCL
85 Carrelages Dino De Cecco

Dans notre espace d’exposition de 1400 m2 nous présentons des idées créatives transformées en carreaux ... Happy to be different Home About Us Videos Contact All photos taken on location in our showroom Z.I
dino-online.lu
86 Home

INL ... Home About us What we do Contact Links Be Captain CLC Cluster for Logistics EC inland waterways
inl.lu
87 Sightseeing.lu SalesLentz

Découvrez Luxembourg à bord du pétrusseexpress ou le sightseeing bus ... MENU Book now Français Deutsch English Book now Français Sightseeing Bus About Schedule & Itinerary
sightseeing.lu
88 Art of Seeing –

... Art of Seeing About Guestbook Contact Copyright th Hamburg Harbour birthday Aerial I
artofseeing.lu
89 Castle Garden | Sûre

Enjoy nature’s tranquillity and our hospitality in one of the rare luxurious ECO villa’s ... mailinglist You will be informed about Castle Garden within a couple of days Castle Garden Sûre Valley Resort
castlegarden.lu
90 Home

... FRIGOFOOD INTERNATIONAL SARL Home Home About Products News Links Contact Frigofood International
frigofood.lu
91 Home | Office du

... Home Contact Liens EN FR Assurance-Crédit Aides financières About us Assurance-Crédit Produits et
odl.lu
92 Feluba Fédération Luxembourgeoise Badminton

... About us Where to play National Championship Masters Events News Contact us Galerie Aktuell th
feluba.lu Badminton Feluba Luxembourg Sport
93 Eva Ferranti

... Home Page Products Brand Stores About Eva Contact “Once a suit has fulfilled its basic use of
evaferranti.lu
94 Images: the photography of

... . --> The photography of Michael Morris contact me Home Galleries Behind the scenes Useful links About
morris.lu
95 JeanClaude Berens – Fine

... Enter About News Blog Galleries Decay Private Residences Industrial Buildungs Public Places Street
urbanvisions.lu
96 Wedding Photography Luxembourg —

... Luxembourg Fresh and Stylish Wedding Photography in Grand Duchy of Luxembourg Hello About Weddings Before
weddingphotography.lu
97 Eastspring Investments

... About Us OUR FUNDS Prices Literature Contact & Information FIXED INCOME EQUITY Mixed Assets Latest
eastspring.lu
98 Welcome to jpt.lu!

... Welcome to jpt! A website about its own existence. ...waitwhat?! Hello there! This little page
jpt.lu
99 Luss.lu www.luss.lu luss

Luss Art is a personal website and portfolio for a luxembourgish artist ... Luss art Home About Me Customizing Airbrush Abstract Figurative Tattoos Decor Contact bstract
luss.lu Luss Luxembourg Luxemburg Art
100 Garage MagirusDeutz Garage
1011
Luxembourg
... Workshop Spare Parts Product Deutz Deutz Products Engines Iveco MWM Fiat Gebrauchtwagen About us Contact
garage-magirus-deutz.lu Garage MagirusDeutz Deutz Fiat Iveco
101 N.E.A.T. Fitness

... . LEARN MORE ABOUT N.E.A.T. > fit lunch Fitness and lunch in less thanminutes! LEARN MORE ABOUT fit
neatfitness.lu
102 LPod End of Season

An image album created with LPod Gallery. ... Home Info About End of Season About L-Pod Lineup Location Media Gallery Partners Partners
endofseason.lu
103 Welcome Erika.lu transformational

Erika Lucivero Certified Life Coach is transforming the world into one where everyone ... erika About Erika Life Coaching Workshop Insights Contact Free Updates Life Coach & Spiritual
erika.lu Transformational Coaching Toronto Connection
104 Bank Leumi Luxembourg

... - Leumi Luxembourg About Us Legal Information Financial Statements Private Banking Products and Services
bankleumi.lu
105 IT Consulting and Development IT

IT Consulting and Development S.à r.l. is specialized in IT consulting and developing websolutions...True to ... Log in + IT Consulting and Development S.à r.l. HomeServices— About Consulting
itcd.lu IT IT Consulting Webdesign Webhosting
106 Nova.lu Informationen zum

nova.lu ist Ihre erste und beste Informationsquelle uuml;ber energie Hier finden Sie auch weitere ... anonymous statistics about you when you visit this website. Cookies are small text files stored on your
nova.lu
107 Referencement.lu Informationen zum

referencement.lu ist Ihre erste und beste Informationsquelle uuml;ber referencement Hier finden Sie auch weitere ... to compile anonymous statistics about you when you visit this website. Cookies are small text files
referencement.lu
108 Reisen.lu Informationen zum

reisen.lu ist Ihre erste und beste Informationsquelle uuml;ber reisen Hier finden Sie auch weitere ... serve ads and to compile anonymous statistics about you when you visit this website. Cookies are small
reisen.lu
109 Centre de langue et

... Services About Us About Us Our School Partners Our Teachers Committee Members Contact Contact Memberships
clccl.lu
110 Prevoyancevieillesse.lu Informationen zum

prevoyancevieillesse.lu ist Ihre erste und beste Informationsquelle uuml;ber prevoyance vieillesse luxembourg Hier finden Sie ... to compile anonymous statistics about you when you visit this website. Cookies are small text files
prevoyance-vieillesse.lu
111 Home

... Skip to content Contact Media Careers Luxembourg >> Global site Home About us Asset classes
avivainvestors.lu
112 Newmedialux.lu Informationen zum

newmedialux.lu ist Ihre erste und beste Informationsquelle uuml;ber Luxembourg Hier finden Sie auch weitere ... to compile anonymous statistics about you when you visit this website. Cookies are small text files
newmedialux.lu
113 Cdr.lu Informationen zum

cdr.lu ist Ihre erste und beste Informationsquelle uuml;ber Cd vierges Hier finden Sie auch ... anonymous statistics about you when you visit this website. Cookies are small text files stored on your
cdr.lu
114 Edison Capital Partners

... Sitemap En De About us Services Past Transactions News Contact Introducing Edison
edison.lu
115 EUSO 2013 Presentation

... Login Home About EUSO Tests pictures Committees Partners Participants Schedule Results Contact News
euso2013.lu
116 TP Vision Global
9052
GENT
... continues to put highly attractive products on the market More about our products OurPhilips TV line
tp-vision.lu
117 Frënn vun der Ënn

... Skip to main content Enn News About Services Donate Support us Wiretransfer Snailmail PayPal
fnf.lu
118 Welcome to my personal

... Home Texts Presentations About Index ToC Texts Overview Enterprise Application Development
daniel-meyer.lu
119 Alfraprog Software indie

Welcome to Alfraprog Software an indie game development site created by Alex Greenwood ... Home Games Cosmoludo Novoludo Freedefeier Services Blog Forum About About Press Contact Welcome to
alfraprog.lu Indie Gamedev Games Casual Retro
120 Frënn vun der Ënn

... Skip to main content Enn News About Services Donate Support us Wiretransfer Snailmail PayPal
enn.lu
121 HOMEPAGE Marc Weis Marc

welcome to the homepage of the nature photographer Marc Weis Luxemburg ... HOMEPAGE Marc Weis Go to content Main menu Home about me biography publications exhibitions awards
marcweis.lu Marc Weis Nature Natur Foto Photo Naturfoto Naturephotography
122 Luxic

... Home About LuxIC Conferences Conference on the role of Intellectual Capital in strengthening SME
luxic.lu
123 Unlimited Matricks

... Welcome to the Unlimited Matricks Homepage Read about the history of ULM Start the Dark Side of the
ulm.lu
124 Verso

... PICTURES EVENTS RESERVATIONS ABOUT News VIP Lounge Are you sick being crushed in the crowd? Do you
verso.lu
125 Ebusiness card

... rafitmckeayryanarainepacketknife abouthours ago ©e-business Card . Blogger Templates
zoller.lu
126 East West Trade

... HOME ABOUT US ESPACE-PRO CONTACT
east-west.lu
127 Home

... Consulting Contact About Us Training room Come and discover our fully equipped training room that is
digiconcept.lu
128 Kuylenstierna Skog S.A

... Home English Swedish Who we are About us History Employees Why choose us Legal authorisation The
k-s.lu
129 Profile | He Lu

Profile of He Lu developer and designer based in Montreal ... Profile Portfolio 中文 Best ofboth worlds I'm He Lua developer and designer from Montreal
ryo.lu
130 Seed to Tree seed

SEED TO TREE Luxembourg's upcoming indie folkpop band ... HOME PHOTOS VIDEOS NEWS STT HIGHLIGHTS! GIGS ABOUT Expert feedback LYRICS STORE IN THE MEDIA
seedtotree.lu Seed To Tree Seedtotree Acoustic Pop Folk Rock
131 Home page | Skipperclub

... / HOME Formations proposées ABOUT US COURSES DETAILS Eaux intérieures Côtier Mer Prise en mains
skipperclub.lu
132 Fund Software Solutions

... Home About AMS FinSoft AMS Group Products RCP - Retrocession Calculation Platform SUN - Sales Unit
amsfs.lu
133 ANCESTRY Europe S.à r.l.

... Menu Close X About Ancestry LLC International Press Releases Contact Us Our mission is to help
ancestryeurope.lu
134 Laurent Calmes' personal homepage

... Laurent Calmes' personal homepage Home About me Binaural sound source localization Basics
laurentcalmes.lu
135 Welcome to LuxConnect |

... About Data center co-location services International connectivity Dark Fiber Media & News Contact
luxconnect.lu
136 L/E Tactical Gear Luxembourg Aimpoint

L/E Tactical Gear OFFICIAL DISTRIBUTOR Aimpoint Luxembourg SureFire Luxembourg 5.11 Luxembourg Cop Nietcore Under ... English We accept Powered by Joomla!® Legal notice - About us
tactical.lu Aimpoint Luxembourg Surefire Luxembourg Nitecore Flaschlight
137 789.lu data aggregator

... aggregating data about luxembourg Weather Weather nuageux Temperature °C
789.lu
138 QUADRIGA LUXEMBOURG HISTORIC
7201
BERELDANGE
QUADRIGA HISTORIC MILITARY VEHICLE COLLECTORS LUXEMBOURG ... QUADRIGA ABOUT PHOTOS VIDEOS AGENDA KEEP'EM ROLLING WE REMEMBER FOR SALE LINKS Barre latérale
quadriga.lu
139 ..:: OmegaVision.lu ::..

... Home Services About OV Support Home Mam OV Sitemin .dem Administratiountool fir Är Websäiten
omegavision.lu
140 Lawyer Firm Marc Kerger

... Home About us Areas of practice Other activities Contact and find us Since Personalized legal
etudekerger.lu
141 Mesa verde

... Opening times About ... Opening times Tuesday to Saturdayfrom h to h WednesdayThursday and
mesa.lu
142 Marxbar.lu

... Menu Club/Lounge Bar About Event Agenda Resident DJ’s Galleries Private Events Contact Opening
marxbar.lu
143 Ring Tour International

Founded 27 years ago by the present Managing Director Tommy Tascijevic RingTours is a ... fr en de About us Group travel - Paris - France - Circuits - Luxembourg - Netherlands - Belgium
travelring.lu
144 LuxHosting Networks Default

... not send mail about this site or its contents to cPanel Inc. or the Apache Group. About cPanel cPanel
schmitz-pelze.lu
145 ADRAD KAYLDALL

... about ADRAD Kayldall Club History years ADRAD Kayldall Membership Monthly meeting FORUM FORUM of
adrad-kayldall.lu
146 LuxHosting Networks Default

... Inc. or the Apache Group. Please do not send mail about this site or its contents to cPanel Inc. or
autex.lu
147 Pets Assistance Company dog

P.A.CO. our services provide the right solutions to pet owners during their absence : ... Home About us Gallery Services Prices Contact Home Our name Pets Assistance Companyhas
paco.lu
148 Home | BAUM management

... . This website aims to inform investors and other stakeholders about the companies’ core values
baummanagement.lu
149 Xtreme

... Home About us Bowling Billard Events Birthdays Contact About us X-TREME BOWLINGPOUR VOTRE PLAISIR
x-treme.lu
150 :: intro :: audiobook

Write Out Loud: Young Luxembourgish writers read from their works. ... simultaneously I realised that hardly anybody knows about them. I asked some creative friends what they thought
write-out-loud.lu Audiobook Luxembourg Luxembourgish Writers Luxembourgish
151 Home

... amendement Procédures de suivi des études Demande d'avis pour un CUP Notification d'un MNP About us
cner.lu
152 DigiKey Electronics | Electronic DigiKey

DigiKey offers over 3.4 Million Electronic Components from Hundreds of Suppliers. Free shipping for orders ... Solutions Sensor Solutions Wireless Solutions ToolsXpressSM Need Help? Learn About Our Homepage How To Order
digikey.lu DigiKey Corp Electronic Components Distributor Electronic
153 Home Rundholz

Rundholz Mode mit Stil eigenwillig besonders fuuml;r die Frau die Mode ... de-h Home About us Nouveautés Galerie photos Plan d'accès Contact Liens Navigation Home
jacky-marcy.lu Rundholz Black Label Dip Privatsachen Gix Nook Lilith
154 Schilder Planen Schilder

Spezialist fuuml;r digitalen Grossformatdruck ... Gadgets Service About Kontakt Anfahrt Anfrage Aktionen Produkte Schilder Baustellen Werbung Baustelle
kopp.lu Schilder Planen Finartdruck Aufkleber
155 RestoDays

... restaurants having Michelin stars fr en KEEP ME POSTED ABOUT THE RESTODAYS We’re looking forward to seeing
restodays.lu
156 IT Services Luxembourg

... Home About AMS Systems PSF AMS Group Services CHG - Change Management INF - Infrastructure
amssys.lu
157 Bauer Capital | home

... about us value add contact links imprint about us Bauer Capital is a well-established real estate
bauercapital.lu
158 Ca2.lu:80

... your desktop where there's net . About ca Know a bit more about ca. developer.ca.cc The web
ca2.lu
159 BITA BeNeLux Home

We supply the BeNeLux Market (Belgium the Netherlands and Luxembourg) with machines tools ... and accessories are structured into different Product Groupscheck PRODUCTS To find out about
bita.lu
160 Business from Me to

... Home About BMY a.s.b.l. We believe Our Vision Business from Me to You a.s.b.l.- General
businessfrommetoyou.lu
161 AgilIT Preferred Dell

AgilIT Preferred Dell Partner ... Agil IT - Complete service for IT infrastructure Home About Services HPC Enterprise Storage
agil-it.lu
162 Alliance Révision SARL Réviseur

... Skip navigation Alliance Revision is a member of search Welcome About Us Our Core Services
alliance-revision.lu
163 Home www.54at105jack.lu

Home www.54at105jack.lu ... Home About me My radio shack My QSL cards Online Logbook Qsl Gallery Online Logbook
54at105jack.lu
164 China Collection: Online Gallery chinese

More than 12 000 pieces of antique and classic Chinese furniture which constitute one of ... China Collection Online Gallery - Home ONLINE CATALOGUE INTERIORS GALLERY DISCOVER ASIA ABOUT US
china.lu Chinese Furniture Luxembourg Furniture Luxembourg Chinese Antiques
165 HochePartners Trust Services s.a.

... Home About us Services Press Contact Sitemap "Through our extensive partner experiencewe advise
hochepartners.lu
166 Thomas Krauss Photographies

... au mois de mai à l'usine la maison du prof de maths my girlz . About Contact Flickr
hurluber.lu
167 Online Marketing Solutions From

We consult in: SEO PPC Website Analytics Email Marketing A/B Testing. ... Optimization Customers Blog About Us Contact Us Request A Quote Get a non-binding quote for your online
online-marketing.lu
168 PAI Home

... Investor log in Language EN FR Printer friendly Home About Us Our Sectors Our Funds Our Team Our
paipartners.lu
169 Fidsna Fiduciaire

... Fiduciaire About us Our services Contact us About us Fiduciaire Scheiwen · Nickels & Associés S.Ã
fidsna.lu
170 Malware.lu Home

... Toggle navigation Articles Malware repository CERT Services About Malware CERT provides incident
malware.lu
171 Domain name has been

... Domain www . .lu.eu.org .biz .info.be .es .fr .it .li .nl .tv .ws Your .lu
domainparking.lu
172 Minivolvo.lu Inventory of miniatures

minivolvo ... models found Help wanted Photo gallery Events Links Volvo Saab Everything else Contact Donate About
minivolvo.lu Miniatures Volvo Volvo Scale Models Volvo
173 Prof. Willie W. LU ITU

Prof. Willie W. LU ... Prof.LU's Key Patents LU's LAW About Prof.LU Mobile Cloud platform Bestselling
willie.lu ITU IEEE Open Wireless Mobile
174 Home Zimmer

... ) - unofficial deadline About About Us Who we are Why working with us About Luxembourg Luxembourg
zimmerpartners.lu
175 Cynart.lu Events in cynart

Cynart ist Veranstalter fuuml;r Events jeder Art in Luxemburg; Konzerte Firmen events Open ... . Click here for more info about us. ♦ We create the original christmas parademore info here . Design by
cynart.lu Cynart Luxemburg Event Veranstalter
176 Www.diffwinds.lu: Home

... Home About us Participation Application Form CDs Photos Press Workshop Videos Contact Next
diffwinds.lu
177 Dissolve your brand joomla

Joomla! the dynamic portal engine and content management system ... Home Services Contact About f Dissolveyour brand & concept pill. Are you having difficulties
dissolve.lu Joomla Joomla
178 IYS 2013 Luxembourg

... Posters Abstracts Gallery Venue About Sponsors Contact CRP-SANTÉCEPS/INSTEAD UNIVERSITY OF LUXEMBOURG
iys2013.lu
179 JA Immobilien Agence

... Français de en pt Search by keywords Home About Ventes Locations Projets Références Contact
jaimmo.lu
180 SENSITY is a horizontal design

SENSITY is a horizontal Design Consultancy. ... economy. NEXT Berlin Guido and Marcel will visit the leading european conference about digital
sensity.lu Design Innovation Training Concept
181 Anglican Church of Luxembourg

... the Anglican Church of Luxembourg. Find all you want to know about the Anglican Church of Luxembourg
anglican.lu
182 Boho

... Dressesskirts Blousesshirts Pants Suits Jackets Inspired by Alexandra Tolstoy News About Regulations
boho.lu
183 Bimaco • Consulting and

... Home About us NAVEX Partners Contact Client area BIMACO Consulting and Design in Financial
bimaco.lu
184 Home LuVEBA S.A. crosscultural

Professional training consulting and human development services for individuals and organizations. ... the quality of our consulting and services. You will find detailed information about our services soon
luveba.lu Crosscultural Training Leadership Development Business Consultant Coaching Outso
185 Lu Bicalho graphic diseño

Lu Bicalho graphic web ilustration ... Lu Bicalho - graphic web & ilustration illustration web graphic about contact hellolubicalho
lubicalho.lu Diseño Grafico Diseño Web Interactive
186 LANDMARK Property Management real

Landmark Property Management SA (Landmark) is a real estate investment company incorporated in Luxembourg in ... About us Countries Portfolio Our team Contact us Home Landmark Property Management SAis
landmark.lu Real Estate Investment Company Eastern Europe Property Development
187 Photography

Luxembourg ... RTL People & Stuff Hipstamatic Family & Friends Old Stuff Guestbook Login About Contact
steichen.lu
188 HOME

... HOME GALLERY STORE BLOG CONTACT HOME GALLERY STORE BLOG CONTACT About My name is Steve Struttmann
spictures.lu
189 Carnegie LU – Banque
1011
Luxembourg
... Banque Carnegie Luxembourg Banque Carnegie Luxembourg Start Private Banking Fund Services About
carnegie.lu
190 Coolbus

... Coolbus Home About Prices Gallery Booking FR EN Start your party on theroad Discover our packages
coolbus.lu
191 INDUSTRIE LUXEMBOURGEOISE DES EQUIPEMENTIERS

... Organisation Mission Managing board About Us Members Luxembourg's Automotive Industry Info
ilea.lu
192 Multifonds investment fund
60325
Frankfurt
Award winning multijurisdictional investment fund software platform for portfolio accounting fund accounting ... Jump to Navigation Search this site English 中文 Home About us Multifonds advantage Multifonds
igefi.lu
193 ATOZ

... About Us Your Challenges Our Solutions Delivering Value Key People Press Corner & Events Thought
atoz.lu
194 Main Page | Axent

... ) Correction About Axent Comité Contact User login Username Password Request new password AXENT a.s.b.l
axent.lu
195 Paul Kayser

... ] Welcome Agenda About Paul Kayser Contact & Booking Reviews Gallery Videos Les Amis de l'Orgue de l'Eglise
organ.lu
196 Home

... pt with questions or comments about this web site. Last modified juin
fiduciaire-kneip.lu
197 Www.mypa.eu joomla

PARFUMES COSMETICS ... customers in more thancountries MYPA About the company Map Perfumes Cosmetics Aloe Vera Shea Karité
mypa.lu Joomla Joomla
198 Home Lux Global

... ) - unofficial deadline About About Us Who we are Why working with us About Luxembourg Luxembourg
luxglobal.lu
199 MariTeam S.A. Maritime Management Mariteam

Mariteam SA provides effective full or part ship management thereby easing day to day ... potential problems Downtime reduction Minimization of owner's administration time Home About us Services
mariteam.lu Mariteam Maritime Managenemt ISM ISPS Technical Management
200 Prof. Willie W. LU ITU

Prof. Willie W. LU ... Prof.LU's Key Patents LU's LAW About Prof.LU Mobile Cloud platform Bestselling
wei.lu ITU IEEE Open Wireless Mobile
201 Upsilon PMS

Upsilon Financial Engineering. Based in Luxembourg Upsilon specialises in developing financial software for ... Scenario Builder Portfolio Dashboard Overview Consolidation Lookthrough Report MiFID © Login About us
upsilon.lu PMS OMS CRM Financial
202 Welcome to Urban Nature

... Design About Urban Nature Gift Cards Shipping
urbannature.lu
203 DiGGiTeam Photo

... Home Contact Agenda Photos Videos About Links Guestbook Welcome to diggi-team
diggi-team.lu
204 Best jobs in finance

... Luxembourg Find a job For companies About us Contact us Job search Select location
roberthalf.lu
205 Bottega Verde Italian Natural

Bottega Verde.eu discloses the beauty thanks to cosmetics containing natural active principles. Discover the new ... Search Free gift in your cart! Cart Overmillion women choose our natural cosmetics. About us
bottegaverde.lu Natural Cosmetics Beauty Products For Women Cosmetics For
206 Home AliaVita Engineering

... Skip over navigation Home About Us Services Process Partners References CSR Blog Contact Us About
ave.lu
207 Parc Le'h Adventures Dudelange saut

Parc Le'h Adventures Dudelange sàrl ... Home Info News Contact us Guestbook Links Find us Events & Openings Explore All information about
aventure.lu Saut à L'élastique Escalade Fun
208 GAM Illustration
1017
Luxembourg
... Home About us Services Portfolio Contact Illustration & Graphic Design concepts Who we are Gam is a
gam.lu
209 Pandomus

... About pandomus Formula Services legal information Publications Career Contact PANDOMUS is a
pandomus.lu
210 Paper Bird

... Home Blog About Projects Music Publishing & Past Projects Contact labour less ¦¦ accomplish more
paperbird.lu
211 FilmFund

... Die Young It's a story about a boy It's a story about a small town; nobody famous ever comes out of a small
en.filmfund.lu
212 Vialegis Home

Home ... handbereik Home About Vialegis Candidates Clients Vacancies CV online News Contact News > More news Looking
vialegis.lu Home
213 WSI Digital Marketing

... Log in Get In Touch With An Expert Home About Us Our Services Our Clients Resources Contact Us Blog
wsiinternetmarketingservices.lu
214 Home rubber

HITEC Luxembourg S.A. a 100%owned Luxembourg company has developed its business activities in ... About Us Vision & Values Portfolio Quick Facts Board of Directors Management Bodies Team History
hitec.lu Rubber Testing Industry IPHT Individual Pellet
215 PMI Luxembourg Chapter

... partaking of the enjoyable food and drinks on offer. Read more about PMI BeLux DAY Log in to post
pmi.lu
216 CEBA.lu : Home

CEBA – Cercle d'Études sur la Bataille des Ardennes – The study group on the ... The CEBA About CEBA The Bulge - Magazine The CEBA Museum The Museum Sherman M Tank German PAK
ceba.lu
217 Index

... private party or public event! Home events gallery gallery f r marche ober nommer random about Contact
fadetogray.lu
218 Cluster Maritime Luxembourgeois

Created in 2008 as a nonprofit organization the Luxembourg Maritime Cluster (CML) brings the ...  Cluster Maritime Luxembourgeois News Hot Topics Breaking News About us Cluster Sector Network
cluster-maritime.lu
219 Sokrates.lu

... Siicht total verwerflech. addthis Read more about „Maacht datwat Hien iech seet! “ – A wann
journeylist.lu
220 Information Market European Union

... Herramientas de accesibilidad Ir al contenido Herramientas de servicio Sitemap About New on EUROPA
echo.lu
221 High quality hosting services

LuxHosting provides high quality webhosting reseller plans managed dedicated servers efficient antispam ... Servers Colocation Housing Online Support Other Services About LuxHosting Contact LuxHosting Promotions
luxhosting.lu
222 Introduction

... About Taplow Client services Executive search Human Capital Services How we help Interim Management
taplow.lu
223 Home | Telindus
4244
Esch sur Alzette
Telindus Telecom Telindus' new operator brand is a new kind of telecom operator ... & Manufacturing Services & Utilities About Telindus About Telindus Telecom Cloud Computing Innovation Belgacom
telindus.lu
224 Intelligence for Finance KYC

Sqope S.A. is a Luxembourgbased company offering premium information (KYC EDD) reports on individuals ... English Français Pу́сский عربي Home About Sqope Solutions Sectors News & Resources Careers
sqope.lu KYC EDD Luxembourg Due Diligence
225 Home | AIMS Luxembourg

... AIMS Luxembourg Home About Mission Statement Philosophy The Team Services Executive Search Talent
aims.lu
226 Claremont Consulting Services

... Claremont Consulting Services Client Services + Home About Our Company Our
claremont.lu
227 Quality Electronics Design S.A. QED
52066
Aachen
QED S.A. develops customerspecific solutions in the fields of measurement regulation and control technology ... Order Book About QED Management Consultancy QED works with you by means of coaching and project
qed.lu QED QED S.A. Quality Electronics Design
228 Metro

... ↑ Press Room Contact us The world's largest newspaper . million daily readers About Metro Facts
metro.lu
229 Nvision a brand

... nvision Menu About Expertise Work Careers Contact Let's create experiences! In a digital world
nvision.lu
230 Welcome to http://www.biiissen.lu/

... If anybody has a good idea for a header px high and aboutpx wide mail me... ;) Home
biiissen.lu
231 Home Luxembourg

Download our applications for iPad  iPhone  Android OFFICES FOR RENT IN THE HEART OF LUXEMBOURG ... Accueil NOUVEAU ! tous nos biens immobiliers neufs SONT sur Yous PROMOTIONS IMMOBILIERES About us
yous.lu
232 Home | CoCoMo

... is to give a qualitative statement about the longevity and sustainability of open source software
cocomo.lu
233 Cougar.lu Music made

... Rainy Day Song About Sadness Take Me With You Troubadour de Troyes Volplane X-Mas In Cairo Please
cougar.lu
234 ICF Luxembourg coaching

The International coaching Federation in Luxembourg is a charter chapter of the ICF Global. ... International Coaching Federation - Luxembourg Home ABOUT ICF Join the ICF ICF Credentials Code of
coachfederation.lu Coaching In Luxembourg Professional Coaches Accredited
235 Discovery Offshore

... Offshore About Us Rig Fleet Investor Relations Contact Us designed by Pixel Creative GroupInc.
discoveryoffshore.lu
236 The relocation in Luxembourg

... the relocation in Luxembourg HOME News from Luxembourg ABOUT US OUR SERVICES CONTACTS
arlux.lu
237 Brainfood alles brainfood

Brainfood besteet aus Artikelen Podcastepisoden an Museksendungen. An der Summervakanz 2009 ass brainfood mam ... episode we talk to Peter Singer and to Jeff Mcmahan about this quotidian moral question. Moderator Joshi
brainfood.lu Brainfood Brainfood.lu Artikelen Podcast
238 Home | Luxembourg Business

... Skip to main content Contact Online platform About For investors For entrepreneurs Blog Events
lban.lu
239 SQL Solutions

... Home About us Services Database Administration & Development IT consultancy Services Project
sql.lu
240 Handelsbanken Handelsbanken

Satisfied customers are what motivates us. That´s why we offer personal service and a full ... of dedicated long-term support. Contact us Careers Private Banking Corporate Banking About the group
svenskahandelsbanken.lu Handelsbanken Handelsbanken Luxembourg
241 Aero Club Dudelange

... ) après h. Read more about Tombola du Meeting du ..
aeroclubdudelange.lu
242 AAL Homepage astronomy
1017
Luxembourg
AAL Astronomes Amateurs du Luxembourg ... MAIN PAGE ABOUT US EVENTS GALLERY FAQ LINKS GUESTBOOK SPECIAL TOPIC CONTACT Moon Phase below Tip
aal.lu Astronomy Astronomie Luxembourg Meteor
243 Ireland Luxembourg Chamber of

ILCC ... Ireland Luxembourg Chamber of Commerce ILCC Home About Us Membership Events News Links Contact Us
ilcc.lu
244 Ptd.lu

... Home About us International Sales Productions E-Shop Contact Rough Road Ahead Christian Frosch
ptd.lu
245 Radio ARA

... Home About us Listen Program Graffiti Blog Bistro Download Advertising Links Contact Radio ARA is
ara.lu
246 Handelsbanken Handelsbanken

Satisfied customers are what motivates us. That´s why we offer personal service and a full ... of dedicated long-term support. Contact us Careers Private Banking Corporate Banking About the group
handelsbanken.lu Handelsbanken Handelsbanken Luxembourg
247 Home

... party came up at one party with the idea to found a club. After same drinks and discussion about the
harleybrothers.lu
248 Opderschmelz centre

centre culturel régional dudelange opderschmelz ... d'utilisateur Mot de passe Annuler AGENDA FESTIVAL & EVENTS ABOUT US ARCHIVES TICKETS PARTENAIRES CONTACT
opderschmelz.lu Centre Culturel Régional Dudelange Opderschmelz
249 Fédération des enrôlés de

... FEDDFFédération des enrôlés de force About Archives Contact Search Recherche avancée Aucun
ons-jongen-a-meedercher.lu
250 PDF.lu Short link

... . For any enquiry about this siteplease use our contact form on pdf-archive. Copyright
pdf.lu
251 Cavem Music school

... Contact shop about us Links online application Small ads courses & fees home calendar Hyperlien
cavem.lu
252 Etude Dan Noel avocat

Etude Dan Noel une des principales études d’avocats à Luxembourg et à Esch/Alzette ... About Us Contact Info © Copyright Sit-Net SA- Etude Dan NOEL
etude-noel.lu Avocat Droit Noel Commercial Assurances Bancaire Luxembourg Domiciliation
253 MC Management Consultants Luxembourg

... Minds wide open - MC Management Consultants Luxembourg Home About Us Our Services Careers Contact
mcluxembourg.lu
254 Home Mantaray Software crm

Mantaray is a leading specialist in CRM and ERP integrated software in Luxembourg that offers ... will look like Use software designed by users for users View our modules Do you have any questions about our
mantaray.lu Crm Software Erp Luxembourg
255 Marco Puetz | Hello

... into the Works/CD section. Read everything about me by browsing the Biography page. Use the Events area
marcopuetz.lu
256 MG Car Club Luxembourg MG

MG Car Club Luxembourg The home of luxembourgish MG drivers ... Links Cars for sale FAQs Contacts in Luxembourg Become a member Contact Us About this site User Menu
mgcarclub.lu MG Car Club Luxembourg
257 WAGNER CITY SARL

... SamediDécembre Menu Accueil Nous contacter About us Location/Vente Location Vente Divers
wagnercity.lu
258 Trovit A search

A free search engine for classified ads. Search real estate to buy or rent ... - Украина - Nigeria - About us Blog Join us Your ads in Trovit Affiliate program FAQ
trovit.lu
259 Tor Project: Anonymity Online anonymity

... Tor Home About Tor Documentation Press Blog Contact Download Volunteer Donate Tor prevents people
torproject.lu Anonymity Online Tor Tor Project
260 EASI | Mobile Apps business

EASI is editor of business software and apps realises software and mobile app development ... colleagues About Events Trainings Blog Contact Us The new generation of Accounting & Purchase software JOIN
easi.lu Business Software Mobile Apps Ict Infrastructure
261 Trusted Data Centre Data

Specialist in ICT solutions in the heart of Europe: from Data Centres to Cloud ... About us EBRC EARTH Values How to find us? Why EBRC? Professional of the Financial Sector EBRC
ebrc.lu Data Center Cloud Services Business
262 Devoteam Group Luxembourg

... Publications About Us Offers Careers Investors Luxembourg International Algeria Austria Belgium
devoteam.lu
263 Innovatum.luonline booking solutions for Online

Votre système de prise de rendez vous en ligne pour entreprises médecins et professions ... Select FR DE EN FR DE EN Menu Home About Solutions Online Booking Demo Web Creation Domain Names
innovatum.lu Online Booking Software Webhosting Domain Names
264 Information technology consulting in Independent

IT WORKS S.A. is an independent information technology consulting firm based in Luxembourg . Our ... News and Updates . Sitemap . Useful Links Home About Us Our Services Virus Threat Center
itworks.lu Independent Consulting Independent Consultant Consultant Indépendant 27001
265 Welcome

... français deutsch english Welcome About us Browse Contact Welcome!! We invite you to browse through
arslibri.lu
266 Bissen Family Genealogy Pages:

... Utahabout Welcome This site contains genealogical information on several lines of the Bissen
bissenfamily.lu
267 Lemon | Event Support

... Home About Offer Technology contact Moast – Creative Studio About Lemon Event Support is a one stop
lemon.lu
268 Welcome to Luxembourg for

... International rankings Partners Quality of life in Luxembourg Learn more about Luxembourg's quality of life Life
logistics.lu
269 Theisen Law avocat

Theisen Law Cabinet d'avocats au Grand Duché du Luxembourg. Présentation du cabinet de ... HOME ABOUT US Our philosophy Our people Our brochure About Luxembourg Luxembourg for finance
theisenlaw.lu Avocat Theisen Schiltz Barbian Cabinet Gesica Salarié Maladie
270 Ties.lu |

... Jump to Navigation Home About-us What we do Who we are Our partners Our successes Services Workshop
ties.lu
271 AGICOA EUROPE luxembourg

AGICOA EUROPE manages audiovisual producers' copyrights. It collects and distributes the payments of royalties to ... En Fr IRRIS Web login Register Contact Sitemap Search About How it works Rightsholders Tools & Help
agicoa-europe.lu Luxembourg Copyright Audiovisual Broadcast
272 Spamkiss.com

... the basic principles of Spamkiss can be found under "About Spamkiss" . Another good source of
allaboutit.lu
273 Velo Cycling Club Schuttrange

Velo Cycling Club Schuttrange Luxembourg ... youth and getting them interested in cycling. Randonee Jeng Majerus About Jeng Majerus le Quotidien
hirondelle.lu
274 PremTech

... from concept through to implementation. Ask for a Quote IT Security & Safety PremTech is not just about
premtech.lu
275 The Film Project |

... Grand Duchy's quality of life. short films about Luxembourg are being presented via this video
promoteluxembourg.lu
276 Home Investor

proservices.lu Office rental and administrative services. Corporate and administrative service provider in Luxembourg ... Home About us About us Why Luxembourg ? Careers Services Provision of fully supported Office
proservices.lu Investor Relations Roadshow Private Placement Office Rental Directorship Investm
277 Pecoma Pension Consulting

Your description goes here ... consulting News About us Network Links Pension Consulting and Management International S.A. PECOMA - your
pecoma.lu
278 Welcome to BCP |

... EN FR Internet Banking Contacts Menu About BCP At a glance Shareholding Financial overview Annual
bcp-bank.lu
279 Home

... Search... About Vision & Principles Key Benefits Parties Technical Parties Operational Partners
emergency.lu
280 Mesh.lu | apps

... Jump to navigation portfolio services about us contact baumert-ent Design Studio Polenta
mesh.lu
281 Home | Maritime affairs

... point of all shipping matters in Luxembourg Luxembourg Maritime Administration Learn about the
maritime.lu
282 VARTA Microbattery Website VARTA Microbattery GmbH Micro
73479
Ellwangen
VARTA Microbattery GmbH: Forschung Entwicklung Produktion Vertrieb und Marketing von BatterieSystemen fuuml;r ... Home Sitemap Imprint de en fr es it py 日本 About us Technologies of the future Products News
varta-microbattery.lu Micro Micro Batteries Battery
283 ULBP Union Luxembourgeoise ULBP

ULBP Union Luxembourgeoise Des Bibliotheques Publiques ... Text version Home page Sitemap Contact About us Constitution Governing board Members
ulbp.lu ULBP Union Luxembourgeoise Des Bibliotheques Publiques Bibliotheques
284 Home | The British

... follow us Linked In Twitter Facebook Xing Contact Create account Become a member Login Home About
bcc.lu
285 Hultafors — Hand tools hand

Hand tools with precision for professional craftsmen. Hultafors offers innovative hand tools with the best ... Skip to content Help links About us Contact us News Country Change country Belgique Français België
hultafors.lu Hand Tools Craftsman Craftsmen Folding Rule Tape Measures
286 POPUP Studio | Make

... Workshops About POPUP Studio About us Press Newsletter FAQ Contact Care & Safety Tips €. items in the
popupstudio.lu
287 Photography by Tom Feltgen

... Home Portfolio Blog About Me Contact Me About Photography by Tom Feltgen Skip to content Home
photography.tom-feltgen.lu
288 ZapFi v4.0

... About ZapFi ZapFi builds a network of sponsored and secure Wi-Fi hotspots through which the
zapfi.lu
289 Futuregrowth Asset Management | agrifund

Futuregrowth Asset Management manages client assets of R100 billion through fixed interest related investment strategies ... About Old Mutual About UFF About Futuregrowth Home Corporate Profiles Agri-Fund Farming in Africa
futuregrowth.lu Agrifund Socially Responsible Investing Fixed Interest Investments
290 Impact Events Luxembourg

Impact Events S.A. is a creative event agency that implements live communication using sustainable communication ... Imprint Skip to content Home About us Work Contact Welcome Impact Events S.A. is a creative event
impactevents.lu
291 Pure play asset management
3011
AG Rotterdam
Robeco is a prominent independent asset manager founded in 1929 in Rotterdam the ... Product Selector Current prices Historical prices Dividend History About us Pure-play asset manager About
robecobank.lu
292 BGP INVESTMENT s.à r.l.

... HOME IMPRINT ABOUT BGP ABOUT BGP History Strategy Structure Board of managers INVESTOR RELATIONS
bgp-investment.lu
293 LPod

LPod S.à r.l. is a young and dynamic media agency from Luxembourg. ... Creations Friendships Services About Contact Loading Fabrik Digital marketing Welcome to our
l-pod.lu
294 The Recruiter : Recruitment

The Recruiter empowers companies in their recruitment and HR projects trusting that Human Factor ... Contact us contacttherecruiter EN FR Home About us The Recruiter Business
therecruiter.lu
295 Alessia Sicav : Investment company Alessia

Alessia Sicav provides performing investment products with an accurate risk profile and management using innovative ... Alessia Sicav Home About us History Products Team Corporate information Distributors Documents
alessia.lu Alessia Sicav Investment Company Luxembourg Funds
296 CIRCL » CIRCL

The Computer Incident Response Center Luxembourg (CIRCL) is a governmentdriven initiative designed to gather ... Home About Team News Services Training Publications Projects Contact The Computer Incident Response
circl.lu
297 ILSF A clear investment

... performance indicators. Find out more about our fund ILSF News Important message to all unitholders All
ilsf.lu
298 :: ASTI FOMA

... home webnight family of youth exhibition & book youth exchanges about us about Steichen partners
foma.lu
299 Modified News gamerdesigns

webSPELL Template by www.gamerdesigns.de ... WILLKOMMEN AUF WWW.Modified About Us Members Matches Servers History Forums Guestbook Registered
modified.lu Gamerdesigns Webspell Template Clan
300 Be Cool Be Geek!

... descriptions Internship offers Partners Be Cool Be Geek! Still dreaming about your future career? We love our
becoolbegeek.lu
301 Mobilu.lu : entreprise mobility

... entreprise mobility services and solutions Just type and press 'enter' HOME ABOUT US SERVICES SOLUTIONS
mobilu.lu
302 Easyrider Rotax racing Luxembourg

Easy Rider is the Luxembourg's source for all Rotax racing parts accessories apparel ... looking for but if we can help in any wayplease do not hesitate to contact us. About us Gallery Delivery
easyrider.lu Luxembourg Racing Rotax Seadoo
303 New Crossfire Your

... bar is located onrue Dicks which is about one block from Place de Paris. Click here for a map to
crossfire.lu
304 Home Degroof Gestion Banque

This website is the official website of Degroof Gestion Institutionnelle – Luxembourg a Luxembourg ... Home News Contact Sitemap About us Our services Investment funds Investor information Open
dgi.lu Banque Degroof Degroof Degroof Gestion Institutionnelle Luxembourg Management
305 Direct.lu Real estate direct.lu

direct.lu Real estate in Luxembourg ... there to assist you in your acquisition or sale. Finance Simulator About Us Contact Copyright ©
direct.lu Direct.lu Real Estate Sell Rent
306 Kauml;fer Club Welcome! Kaefer
4901
Bascharage
Kaefer Club ... Home Events Fotos & Videos Kleinanzeigen About us News Clubgeschichte Vorstand - Comité Kontakt
kaefer.lu Kaefer Club
307 Isuivi le suivi de

... révolutionnaire” John Smith Want to stay informed? Follow us. about us Copyright ©Immosolutions Design by
isuivi.lu
308 Welcome: Luxemburg Investment Solutions

... properly. Print this page Imprint About us Services Documents News Career Contact Welcome Luxembourg
investment-solutions.lu
309 Jobluxembourg.lu Offres d'emploi offre

Jobluxembourg.lu Site d'offres d'emploi au Grand Duché de Luxembourg Trouvez votre futur emploi ... services to boost your career. " About Who are we? Contact us Publish on the site Career services Legal
jobluxembourg.lu Offre Emploi Offre D’emploi Recrutement
310 Reiki Luxembourg Reiki

Reiki Behandlungen von diplomierten ReikiMeisterinnen in angenehmen Ambiente in Luxemburg Bous und EschAlzette. ... . HERE you can view a documentary about REIKI-ENERGYaered by RTL onJanuary . It is the second
reiki-energy.lu Reiki Luxemburg Luxembourg Behandlung
311 Www.sandweilerschoulen.lu: Home

... version feedback and bug reports about last site update Tout contenu ©
sandweiler-schoulen.lu
312 RelisNew > Home

... Login Search Home About us The National Focal Points Library Contact EMCDDA Links You are here
relis.lu
313 Home Page Resource

Powered by BaseKit ... Accountants In England & Wales Home Page About Us Key Personnel Services Fees & Terms Contact Client News
resource.lu Resource Revision Sàrl Luxembourg
314 RIPA Electric

... Gazon Synthétique Equipement Terrain News Bienvenue sur notre nouveau site Internet ! Read more about
ripa.lu
315 HRG Luxembourg: Home

... - Select language - English German French Go Home About us Our Services Traveltools News Contact
select.lu
316 Bowling Bowling

Bowling ... FOETZ Bienvenue PÉTANGE Bienvenue About us X-Treme Bowling & Billards vous accueille tous les
bowling.lu Bowling
317 Home PORTAL

... Go to content Go to footer Welcome to the AXA IM Corporate website About AXA IM Multi-expert model
axa-im.lu
318 Firm Linari Law lawer

Linari Law Firm is an independent law firm based in Luxembourg one of the ... and flexible approach. What we trust insays a lot about us HERBERGEMENT WEB AU LUXEMBOURG
linari-law.lu Lawer Linari Avocat
319 Home | Welcome to Luxembourg

Rational Emotive Behavioral Therapy REBT psychotherapy Blanke Albert Ellis Robert ... Therapy – LiREBT. On the following pages you can find information about REBTthe institute and
lirebt.lu Luxembourg Institute For Rational Emotive Behavioral Therap
320 Home | LetzBio

Building bright futures together ... excel in life sciences in Luxembourg All you need to know about life sciences researchinvestingand
letzbio.lu
321 Home labsolution

labsolution Laboratory Informations Systems (LIS). ... about us our servicesproductspartners and team. news we enlarge our team labsolution is looking for
labsolution.lu
322 Hultafors — Hand tools hand

Hand tools with precision for professional craftsmen. Hultafors offers innovative hand tools with the best ... Skip to content Help links About us Contact us News Country Change country Belgique Français België
snickersworkwear.lu Hand Tools Craftsman Craftsmen Folding Rule Tape Measures
323 Stagemusic

... Hot deals New products Catalogue About us Contact us Hot deals New products All brands
stagemusic.lu
324 ALD Automotive: operational leasing

... switch Product International fleets International fleet solutions Services Network About ALD Automotive
aldautomotive.lu
325 4motion.lu

... in Wexford . More infos at www.epto.org Read more about Cultivating capacities for quality peer
4motion.lu
326 A3a homepage Senioren

a3a: alles rundum das dritte Alter: wir helfen Senioren mit Bildungsfragen Website Entwicklung ... ©- webdesign JoPeeDesign ; based on a Wordpress theme Pages Home About us Our Offer Conditions
a3a.lu Senioren Bildung Aushilfe Website Entwicklung
327 Home | 1on1

... Available Space About us Contact Prev Next This is the one! One on One is a jewel of modern architecture
1on1.lu
328 Carl Kliem Home

Home ... Products. Read more about Carl Kliem News -- Luxembourg for Finance "Be part of the future"- check
carlkliem.lu
329 Home

... Ex Libris Video Musek About me Workshops Webdesign Artfactory Biergerblat Shop Gallery Open
baustert.lu
330 Bienvenue à Beaufort |

... Passer la navigation Changer de langue de fr ne en Home ABOUT US Hébergement Gastronomie Loisirs
beaufort-tourisme.lu
331 Home Chapter1

Chapter1 Books. The only specialist English bookshop in Luxembourg. We also stock British Magazines Papers ... Search Menu HomeChapter About Us Books New releases Bestsellers Book reviews Children's Books
chapter1.lu Chapter1 Chapter One Books
332 LuxHosting Networks SARL

... servers Network Issues Read about current and scheduled network outages Language
client.lu
333 Welcome: Compliance Partners

... page Imprint About us Who we are Our clients Benefits Our Industry Our management team Services
compliance-partners.lu
334 Coniston Sàrl Luxembourg

... Coniston Sàrl Luxembourg - Trading & Services Home About Us Services Products Partners Warehousing
coniston.lu
335 Welcome to InfoServ |

InfoServ Informatic Services Marc Gaub ... InfoServ Informatic Services Marc GAUB Site Navigation Home About Support Service Status
infoserv.lu
336 Home healthy

Healthy living Homeopathy Reflexology Pregnancy Luxembourg ... About the treatment The Benefits How long is a session Tibetan Back Reflexology Ayurvedic Reflexology
healthyliving.lu Healthy Living Homeopathy Reflexology Pregnancy
337 Www.hesperschoulen.lu: Home

... version feedback and bug reports about last site update Tout contenu ©
hesperschoulen.lu
338 IDPont DigitalMedia

... About us Know-how & Advisory The people behind IDPoint DigitalMedia SA were involved since the early
idpoint.lu
339 Hultafors — Hand tools hand

Hand tools with precision for professional craftsmen. Hultafors offers innovative hand tools with the best ... Skip to content Help links About us Contact us News Country Change country Belgique Français België
hultaforsgroup.lu Hand Tools Craftsman Craftsmen Folding Rule Tape Measures
340 ImmoFast Prestigious Real

IMMOFAST développe et réalise des projets immobiliers d’exception et de prestige au Luxembourg. ... Home About us Latest project For sale Contact EN FR Welcome Founded on the basis of years of
immofast.lu
341 Portrait Photography in Luxembourg portrait

Portrait Photography in Luxembourg and Belgium by Stephen Roberts Photography ... From Stephen Roberts Photography home l about l gallery l contact Stunning portraits in your home
portraits.lu Portrait Photographer Photography Professional
342 Prodata Systems ICT
4460
GRACE-HOLLOGNE
... About Prodata Systems Vision & mission Values Partners Careers News Prodata ICT Systems is an engaged
prodata-systems.lu
343 Pharus ManCo Luxembourg Pharus

Pharus ManCo Luxembourg ... About us Company Overview Our Group Services Clients Documents Contact Welcome Pharus Management
pharusmanco.lu Pharus ManCo Luxembourg
344 Welcome to Prisma Translation

Prisma your financial document management company in Luxembourg ... About us Client needs Our services News Contact Downloads - Legal disclaimer facebook linkedin
prisma.lu Translation Typesetting Print Distribution
345 Home: ALPC
1030
Luxembourg
... Association Luxembourgeoise des Pédagogues Curatifs Deutsch Français Home About Heilpädagogik
alpc.lu
346 Home

... miracle Einstein To listen Wondering about the uniqueness of a person telling her story anonymous If
accompany.lu
347 International Gendarmerie and Police

... du Musée - this is an association homepage - More informations about the Police Grand-Ducale of
gendarmerie.lu
348 Main : arnaud mouriamé

... Magazine Landart Black Sessions Films Info About rue Michel Rodange L-
graphicdesign.lu
349 Global IT Services Luxembourg mobile

GITS Global IT Services in Luxembourg provides IT solution to large and medium enterprises. IT ... ENG FRA Home About Us Services & Solutions Partners Threat Centre Downloads Contact Us GITS PSF
gits.lu Mobile Telecommunications Industry Mobile Telecommunications Solutions
350 Home Glass

... Glass Consultancy Training Blog Glass.Mapper About Where Signup Glass Glass is home to the very
glass.lu
351 Go Gusto

... Cart is empty GoGusto Home About Philosophy Our Story Products Categories Gift Vouchers Juice Detox
gogusto.lu
352 Naturfleesch

... About us Products Photo Gallery Contact Willkommen! Bienvenue! Willkommen auf unserer Homepage
naturfleesch.lu
353 NoSpeedLimit Stroossen Home welcome

NoSpeedLimit Stroossen is a club for amateur runners and nordic walkers. ... about any kind of financial or logistical support. We thank you very much. Copyright © -
nospeedlimit.lu Welcome Welkom
354 Home General Patton Memorial General

General Patton Memorial Museum ... /Kontakt Photos Videos News The Person The Patton Prayer The Speech Photos Videos War EX-LIBRIS About
patton.lu General Patton Memorial Museum Museum Patton
355 Home | CapitalAtWork
2018
Antwerp
... Skip to main content EN NL FR DE My Capital Main menu Home Asset management Estate planning About
capitalatwork.lu
356 EFG Bank Luxembourg

... eBanking login Information about security Member of EFG International EFG BankS.A. is part of
efgbank.lu
357 Eurobasket club

... Tournament. More information www.bascol About Eurobasket club History Honours Team A Team B Players Press
eurobasket.lu
358 Food for your Senses

... have ideasplease get in touch with infoffys. more info about the… Read more › Hardcover Tickets
ffys.lu
359 Centre d'Escrime du Nord

... to infoescrime with questions or comments about this web site. Copyright ©Centre d'Escrime
escrime.lu
360 Extrafund Sicav

... information about these compartments is not authorized on Internet. Si prega di selezionare il proprio Paese
extrafundsicav.lu
361 Eurodanse | Member of

... About us Statuts Courses Where When Program Registration Dance partner search Calendar Course schedule
eurodanse.lu
362 Magellan | Yacht Management

... Skip to main content Magellan Menu principal Home About Us Magellan Management & Consulting News
mmc.lu
363 Montana United for Coil

Montana Global Fastening solutions. We offer high quality tools and fasteners serving industrial and ... Start Page Dealers About Media ONLY THE HIGHEST QUALITY We bring huge experience from the field of
montana.lu Coil Nailer Pneumatic Tools
364 Home Luxembourg Waterski

... people water skiwhich is the third family sport. Europe counts aboutpeople who water
lwwf.lu
365 MAYFAIR TRUST S.à r.l.

... clients in achieving their goals. Find out more about Mayfair Trust S.Ã r.l Our Values Mayfair Trust S.Ã
mayfair.lu
366 Minerva Research

... WELCOME ABOUT SERVICES RESOURCES CONTACT Specialists in Research Economics and financial markets
minerva.lu
367 VOIPUSER.lu

... that the first web-site in Luxembourg providing informations and documentations about open source IP
voip-user.lu
368 EUROMOVERS people moved

... Home Contact Imprint Privacy Sitemap About Partners Services Business Solutions
tranelux.lu
369 Webanywhere Luxembourg | eLearning

... Skip to main content Home Products Partners About Portfolio Contact Webanywhere e-learning and web
webanywhere.lu
370 Tshirt24.lu TShirt

TShirt Textildruck! Wir bedrucken alle Textilien! Shirtshop mit online Designer! Luxembourg's 1. Adresse fuuml;r Textildruck! ... Flexdrucktshirt.luspreadshirt T-Shirtshopgestalten von Shirtsgünstig Shirt bedruckenLuxembourg
tshirt24.lu TShirt Shirt Bedrucken Shirtshop Tshirt
371 Trikke Europe language trike
2495
AL Den Haag
Copyright © 2013 Trikke Europe BV ... Home Trikke Trikke Electric Trikke HPV Trikke Skki Find Trikke dealer Business Blog About us
trikke.lu Trike Tricycle Three Wheel 3
372 Cresco Urban Yurt

Cresco Urban Yurt is an integrated development and operating company for student housing and serviced ... Group to seed the strategy. The Company currently has about apartments under development and
cuy.lu
373 Air Traffic Control Luxembourg

... Luxembourg ATC since Home Site Updates Airport Info ATC Job About GLCCA GLCCA News Multimedia
atc.lu
374 WTT Wood

WTT wood and biomass trader / trading company as well as project development ... Contact All about wood and energy Home Home WTT - Wood Trading & Technologies All about wood and energy
wtt.lu
375 EKenz

... Jump to navigation Jobs Contact Home About us Business solutions Packages References News lien SAP
e-kenz.lu
376 Diffractis IT Financial

Diffractis offers IT financial consulting services. We are specialized in financial technology and financial software ... Your Financial IT Partner EN Growth principle Agile by nature Home News About us Services Contact
diffractis.lu
377 Revolux S.àR.L. IDEP.NET

Revolux with a very wide range of skills is the developer of IDEP/CN8 ...  Revolux S.à R.L. Home About Products Services Support Jobs Links Contact Welcome Revolux is a
revolux.lu IDEP.NET IDEP/CN8 IDEP.WEB Consultancy
378 Landscape.lu photography

Photography Blog by Maciej Markiewicz Landscape Photography ... Home About Me My prints Fine Art America Fine Art Europe My prints on Artflakes Promotion and
landscape.lu Photography Landscape Luxembourg Sony Alpha Maciej B. Markiewicz
379 Welcome to SOFICODEC

Main page of SOFICODEC website ... About Us Services Why Luxembourg? Contacts +    Site map — we are fiduciary company
soficodec.lu
380 51Biz Luxembourg | Management

... Biz Luxembourg Management Consultants About Biz Login About Biz and PPMB Luxembourg Sun
51biz.lu
381 Centralis Group SA Centralis Switzerland GmbH
1204
Geneva
Centralis S.A Corporate and Trust services: domiciliation accounting financial services tax ... International Corporate Services Toggle navigation Home About Us Corporate Overview Our People Our
centralis.lu
382 EducDesign: Home

... and you pay for the diskspace you really need. more about OLEFA more products EduCare EducDesign
innovation.lu
383 Home

... Home Contact Who's who About ILA Board of Directors Management Committee Executive Committee
ila.lu
384 Welcome | Hockey Club

Hockey Club Luxembourg ... Friday Ladies Tour Luxury Tour Samba Tour Contact Junior News Training Schedule About Committee
hockey.lu
385 Home | ALRiM

... Login Username Password Request new password All about ALRiM Download Center ALRiM Risk Newsletters
alrim.lu
386 GSEC IT Security security

GSEC Security Training Research Awarness ... indepndant group of Information Security Specialits based in Luxembourg. More information » About G-SEC™ G
g-sec.lu Security Sécurité Luxembourg Luxemburg Sicherheit Cssf Psf Luxembutg
387 Maastricht in oude Ansichtkaarten Maastricht

Oude ansichtkaarten van de oudste stad van Nederland vanaf 1898 tot de jaren zestig ... Maastricht in oude Ansichtkaarten Ga naar de inhoud Hoofdmenu Homepage About Photo Gallery Bassin
maastricht.lu Maastricht Ansichtkaarten Oud Oude Foto's Ansichten Vrijthof Fort
388 Threadneedle Investments Luxembourg threadneedle

Our expertise lies in meeting the investment needs of our clients. Our investment professionals work ... navigation About us X About Us Investment Philosophy Awards Our People Corporate Responsibility The
threadneedle.lu Threadneedle Luxembourg Asset Management Investment Market Oeic Sicav
389 Societe Generale Bank

... SogecashWeb Nominet Liquidity Management Clearing services Global Fund Trading SGSS Gallery MENU About us Your
sgbt.lu
390 Unilever global company website

At Unilever we meet everyday needs for nutrition hygiene and personal care with brands ... About us Find out about our historymission and corporate structureand the way we do business
unilever.lu
391 Design Friends: Home Luxembourg

Design Friends is a nonprofit association gathering together people who are interested in design and ... Home About Events News Posters Publications Portfolios Contact subscribe to newsletter we are on
designfriends.lu Luxembourg Design Friends
392 Kaspersky Lab: Antivirus software antivirus
85055
Ingolstadt
Antivirus software for home or business. The world's fastest antivirus updates. Free virus scan and ... Trials Site Map Products & Services Online Shop Threats Downloads Support Partners About Us New!Version
kaspersky.lu Antivirus Kaspersky Lab
393 Home | Lions Club Lions

Lions Club Erasmus Luxembourg official site ... Lions Club Erasmus Home Coins for Kids Press cuttings Lions Club Erasmus About Club contact details
lionscluberasmus.lu Lions Club Erasmus Erasmus Lions Luxembourg
394 TenTwentyFour S.à r.l. |

TenTwentyFour is a startup developing software based on agile methodologies such as behaviour driven development. ... .lu Services Know-How About Us Contact Blog Jobs Delivering software that's been proven to do
tentwentyfour.lu
395 3PM

Third party maketeer asset management Europe ... The Pan-European Third Party Marketeer for Asset Managers About Our Coverage A Selection of our
3pm.lu
396 Complix

... About Strategy Management Board of directors Investors Technology The Alphabody Advantage The
complix.lu
397 TenTwentyFour S.à r.l. |

TenTwentyFour is a startup developing software based on agile methodologies such as behaviour driven development. ... .lu Services Know-How About Us Contact Blog Jobs Delivering software that's been proven to do
1024.lu
398 Allied Telesis | Luxembourg
1437
EK Rozenburg
... . Learn more about how we can design a solution focused on your business. Learn More Solutions Overview
alliedtelesis.lu
399 MG Investments MG

... . Investment Professionals Private Investors For private investors who seek to find more information about M&G
mandg.lu
400 Lux future lab

Business Incubator in Luxembourg ... Home About Us Entrepreneurs Who should apply Selection criteria Application process Apply
luxfuturelab.lu
401 Management Courses Language

... tower training & consulting Site Web Search Register Login Home In-house Power Lunch About Us Who
ttc.lu
402 The Network Connecting women

The Network is a way for women to leverage their networks open to women ... MEMBERSHIP Register Corporate Membership About Us Why Join Membership Benefits Newsletter Archive DIRECTORY
thenetwork.lu Women Networking In Luxembourg Women's Network
403 Christina Schaffer Christina

Portfolio and CV/ Christina Schaffer Art Direction/ Film and Movie Industry ... www.houseofboys This film is about youthfreedomadventure and the discovery of responsibilities in life. In the
christinaschaffer.lu Christina Schaffer Filmarchitekt Szenenbild Samsa

About Bewertung Bewertung:

Die Öffnungszeiten können zu Feiertagen Karneval, Valentinstag, Ostern (Karfreitag Ostersonntag Ostermontag), Tag der Arbeit und Himmelfahrt abweichen.
Ergebnisse der Auswertung: 75 Bewertungen ergeben 4 StadtBranche Punkte

Neuer Eintrag 

About ist der Familienname folgender Personen: About Öffnungszeit und Erfahrungen
Tipps & Tricks für Arbeit & Leben: